BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
50084326	CCCCCCN(CCCCCC)C(=O)Cc1c([nH]c2ccccc12)-c1ccc(F)cc1	InChI=1S/C28H37FN2O/c1-3-5-7-11-19-31(20-12-8-6-4-2)27(32)21-25-24-13-9-10-14-26(24)30-28(25)22-15-17-23(29)18-16-22/h9-10,13-18,30H,3-8,11-12,19-21H2,1-2H3	VUWXAQFLTSBUDB-UHFFFAOYSA-N	50045877	2-(2-(4-fluorophenyl)-1H-indol-3-yl)-N,N-dihexylacetamide::2-[2-(4-Fluoro-phenyl)-1H-indol-3-yl]-N,N-dihexyl-acetamide::CHEMBL63154::[N,N-di-n-hexyl-2-(4-fluorophenyl) indole-3-acetamide]	Translocator protein	Mus musculus		 10							ChEMBL	10.1021/jm960084f	10.7270/Q2H1314Z	8691438			TenBrink, RE; Bergh, CL; Duncan, JN; Harris, DW; Huff, RM; Lahti, RA; Lawson, CF; Lutzke, BS; Martin, IJ; Rees, SA; Schlachter, SK; Sih, JC; Smith, MW	Pharmacia & Upjohn	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50045877	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000534&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50045877&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			132496	103976749		CHEMBL63154				ZINC03780965	1	MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE		Translocator protein	TSPO_MOUSE	P50637	Q541E3 Q62118 Q6LCZ0 Q99M32						
50084340	CN1c2ccc(Cl)cc2C(=NCC1=O)c1ccc(Cl)cc1	InChI=1S/C16H12Cl2N2O/c1-20-14-7-6-12(18)8-13(14)16(19-9-15(20)21)10-2-4-11(17)5-3-10/h2-8H,9H2,1H3	PUMYFTJOWAJIKF-UHFFFAOYSA-N	22040	4 -chlorodiazepam::4' Cl-diazepam::7-chloro-5-(4-chlorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepin-2-one::7-chloro-5-(4-chlorophenyl)-1-methyl-2,3-dihydro-1H-1,4-benzodiazepin-2-one::CHEMBL286346::Ro 5-4864::Ro-05-4864::Ro-4864::Ro5-4864	Translocator protein	Mus musculus		 10							ChEMBL	10.1021/jm960084f	10.7270/Q2H1314Z	8691438			TenBrink, RE; Bergh, CL; Duncan, JN; Harris, DW; Huff, RM; Lahti, RA; Lawson, CF; Lutzke, BS; Martin, IJ; Rees, SA; Schlachter, SK; Sih, JC; Smith, MW	Pharmacia & Upjohn	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=22040	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000534&target=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=22040&enzyme=Translocator+protein&column=ki&startPg=0&Increment=50&submit=Search			1688	49845857		CHEMBL286346				ZINC00347533	1	MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE		Translocator protein	TSPO_MOUSE	P50637	Q541E3 Q62118 Q6LCZ0 Q99M32