BDBM394584 2-(6-amino-5-(1-methyl-::US10308614, Example 187

SMILES Cn1cc(cn1)-c1cc(nnc1N)-c1ccccc1O

InChI Key InChIKey=JISLSABSHWDDTJ-UHFFFAOYSA-N

Data  3 IC50  2 Kd

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 7 hits for monomerid = 394584   

TargetProtein polybromo-1 [645-766](Human)
Genentech

US Patent
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataIC50: 3.70nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvprgsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSELP...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/15/2020
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataIC50: 10nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvprgsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLP...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/15/2020
Entry Details
US Patent

TargetProbable global transcription activator SNF2L2(Human)
University of Michigan

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataKd:  10nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details PubMed
TargetProbable global transcription activator SNF2L2(Human)
University of Michigan

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataKd:  10nMAssay Description:Binding affinity to SMARCA2 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/14/2024
Entry Details
PubMed
TargetTranscription activator BRG1 [1448-1575](Human)
Genentech

US Patent
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataIC50: 12.8nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/15/2020
Entry Details
US Patent

TargetTranscription activator BRG1(Human)
University of Michigan

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataKd:  13nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/6/2026
Entry Details PubMed
TargetTranscription activator BRG1(Human)
University of Michigan

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 394584BDBM394584(US10308614, Example 187 | 2-(6-amino-5-(1-methyl-)
Affinity DataKd:  1.28E+4nMAssay Description:Binding affinity to SMARCA4 (unknown origin)More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/14/2024
Entry Details
PubMed