BDBM50246253 4-(1-isopropyl-2-methyl-1H-imidazol-5-yl)-N-(4-(methylsulfonyl)phenyl)pyrimidin-2-amine::AZD-5438::CHEMBL488436
SMILES CC(C)n1c(C)ncc1-c1ccnc(Nc2ccc(cc2)S(C)(=O)=O)n1
InChI Key InChIKey=WJRRGYBTGDJBFX-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 33 hits for monomerid = 50246253
Affinity DataIC50: 6nMAssay Description:Inhibition of Cyclin E/CDK2More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK2/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 6.10nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 12nMAssay Description:Inhibition of His-tagged full length human recombinant CDK9/cyclinT1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 60 mins...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 14nMAssay Description:Inhibition of recombinant CDK5/p35 (unknown origin) using AKKPKTPKKAKKL-OH as substrate by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataIC50: 16nMAssay Description:Inhibition of Cyclin B1/CDK1More data for this Ligand-Target Pair
Affinity DataIC50: 16nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 16nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 18nMAssay Description:Inhibition of CDK9 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 20nMAssay Description:Inhibition of Cyclin T/CDK9More data for this Ligand-Target Pair
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK9 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK9/cyclin T1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 21nMAssay Description:Inhibition of Cyclin D3/CDK6More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Southern Medical University
Curated by ChEMBL
Southern Medical University
Curated by ChEMBL
Affinity DataIC50: 21nMAssay Description:Inhibition of recombinant human CDK6/cyclin D3 by KinaseProfiler analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 22nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Human)
Southern Medical University
Curated by ChEMBL
Southern Medical University
Curated by ChEMBL
Affinity DataIC50: 34nMAssay Description:Inhibition of CDK2/cyclin A (unknown origin) using lipid substrate incubated for 40 mins in presence of ATP by Kinase-Glo assayMore data for this Ligand-Target Pair
Affinity DataIC50: 35nMAssay Description:Inhibition of CDK1/cyclA2 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Human)
Shenyang Pharmaceutical University
Curated by ChEMBL
Shenyang Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK4/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
Affinity DataIC50: 45nMAssay Description:Inhibition of Cyclin A/CDK2More data for this Ligand-Target Pair
Affinity DataIC50: 45nMAssay Description:Inhibition of CDK2/cyclin A2 (unknown origin) using histone H1 and ATP as substrate incubated for 40 mins by kinase-glo luminescence assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Southern Medical University
Curated by ChEMBL
Southern Medical University
Curated by ChEMBL
Affinity DataIC50: 167nMAssay Description:Inhibition of CDK6/cycD3 (unknown origin) by ADP-Glo assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
Southern Medical University
Curated by ChEMBL
Southern Medical University
Curated by ChEMBL
Affinity DataIC50: 449nMAssay Description:Inhibition of recombinant CDK4/cyclin D (unknown origin) using retinoblastoma substrate by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataIC50: 821nMAssay Description:Inhibition of recombinant human CDK7/cyclin H by KinaseProfiler analysisMore data for this Ligand-Target Pair
Affinity DataKd: 2.60E+3nMAssay Description:Briefly, 5 mg of a protein mixture of the four cell lines or a single cell line were incubated with compound dilution series in DMSO (3 nM, 10 nM, 30...More data for this Ligand-Target Pair
Affinity DataIC50: 3.20E+3nMAssay Description:Inhibition of human ERG by patch clamp assayMore data for this Ligand-Target Pair
Affinity DataKd: 1.80E+6nMAssay Description:Binding affinity to CDK9/Cyclin T1 (unknown origin) assessed as dissociation constant by surface plasmon resonance assayMore data for this Ligand-Target Pair
