BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Date of publication	Date in BindingDB	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID	PubChem SID	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence 1	PDB ID(s) of Target Chain 1	UniProt (SwissProt) Recommended Name of Target Chain 1	UniProt (SwissProt) Entry Name of Target Chain 1	UniProt (SwissProt) Primary ID of Target Chain 1	UniProt (SwissProt) Secondary ID(s) of Target Chain 1	UniProt (SwissProt) Alternative ID(s) of Target Chain 1	UniProt (TrEMBL) Submitted Name of Target Chain 1	UniProt (TrEMBL) Entry Name of Target Chain 1	UniProt (TrEMBL) Primary ID of Target Chain 1	UniProt (TrEMBL) Secondary ID(s) of Target Chain 1	UniProt (TrEMBL) Alternative ID(s) of Target Chain 1	BindingDB Target Chain Sequence 2	PDB ID(s) of Target Chain 2	UniProt (SwissProt) Recommended Name of Target Chain 2	UniProt (SwissProt) Entry Name of Target Chain 2	UniProt (SwissProt) Primary ID of Target Chain 2	UniProt (SwissProt) Secondary ID(s) of Target Chain 2	UniProt (SwissProt) Alternative ID(s) of Target Chain 2	UniProt (TrEMBL) Submitted Name of Target Chain 2	UniProt (TrEMBL) Entry Name of Target Chain 2	UniProt (TrEMBL) Primary ID of Target Chain 2	UniProt (TrEMBL) Secondary ID(s) of Target Chain 2	UniProt (TrEMBL) Alternative ID(s) of Target Chain 2	BindingDB Target Chain Sequence 3	PDB ID(s) of Target Chain 3	UniProt (SwissProt) Recommended Name of Target Chain 3	UniProt (SwissProt) Entry Name of Target Chain 3	UniProt (SwissProt) Primary ID of Target Chain 3	UniProt (SwissProt) Secondary ID(s) of Target Chain 3	UniProt (SwissProt) Alternative ID(s) of Target Chain 3	UniProt (TrEMBL) Submitted Name of Target Chain 3	UniProt (TrEMBL) Entry Name of Target Chain 3	UniProt (TrEMBL) Primary ID of Target Chain 3	UniProt (TrEMBL) Secondary ID(s) of Target Chain 3	UniProt (TrEMBL) Alternative ID(s) of Target Chain 3	BindingDB Target Chain Sequence 4	PDB ID(s) of Target Chain 4	UniProt (SwissProt) Recommended Name of Target Chain 4	UniProt (SwissProt) Entry Name of Target Chain 4	UniProt (SwissProt) Primary ID of Target Chain 4	UniProt (SwissProt) Secondary ID(s) of Target Chain 4	UniProt (SwissProt) Alternative ID(s) of Target Chain 4	UniProt (TrEMBL) Submitted Name of Target Chain 4	UniProt (TrEMBL) Entry Name of Target Chain 4	UniProt (TrEMBL) Primary ID of Target Chain 4	UniProt (TrEMBL) Secondary ID(s) of Target Chain 4	UniProt (TrEMBL) Alternative ID(s) of Target Chain 4	BindingDB Target Chain Sequence 5	PDB ID(s) of Target Chain 5	UniProt (SwissProt) Recommended Name of Target Chain 5	UniProt (SwissProt) Entry Name of Target Chain 5	UniProt (SwissProt) Primary ID of Target Chain 5	UniProt (SwissProt) Secondary ID(s) of Target Chain 5	UniProt (SwissProt) Alternative ID(s) of Target Chain 5	UniProt (TrEMBL) Submitted Name of Target Chain 5	UniProt (TrEMBL) Entry Name of Target Chain 5	UniProt (TrEMBL) Primary ID of Target Chain 5	UniProt (TrEMBL) Secondary ID(s) of Target Chain 5	UniProt (TrEMBL) Alternative ID(s) of Target Chain 5	BindingDB Target Chain Sequence 6	PDB ID(s) of Target Chain 6	UniProt (SwissProt) Recommended Name of Target Chain 6	UniProt (SwissProt) Entry Name of Target Chain 6	UniProt (SwissProt) Primary ID of Target Chain 6	UniProt (SwissProt) Secondary ID(s) of Target Chain 6	UniProt (SwissProt) Alternative ID(s) of Target Chain 6	UniProt (TrEMBL) Submitted Name of Target Chain 6	UniProt (TrEMBL) Entry Name of Target Chain 6	UniProt (TrEMBL) Primary ID of Target Chain 6	UniProt (TrEMBL) Secondary ID(s) of Target Chain 6	UniProt (TrEMBL) Alternative ID(s) of Target Chain 6	BindingDB Target Chain Sequence 7	PDB ID(s) of Target Chain 7	UniProt (SwissProt) Recommended Name of Target Chain 7	UniProt (SwissProt) Entry Name of Target Chain 7	UniProt (SwissProt) Primary ID of Target Chain 7	UniProt (SwissProt) Secondary ID(s) of Target Chain 7	UniProt (SwissProt) Alternative ID(s) of Target Chain 7	UniProt (TrEMBL) Submitted Name of Target Chain 7	UniProt (TrEMBL) Entry Name of Target Chain 7	UniProt (TrEMBL) Primary ID of Target Chain 7	UniProt (TrEMBL) Secondary ID(s) of Target Chain 7	UniProt (TrEMBL) Alternative ID(s) of Target Chain 7	BindingDB Target Chain Sequence 8	PDB ID(s) of Target Chain 8	UniProt (SwissProt) Recommended Name of Target Chain 8	UniProt (SwissProt) Entry Name of Target Chain 8	UniProt (SwissProt) Primary ID of Target Chain 8	UniProt (SwissProt) Secondary ID(s) of Target Chain 8	UniProt (SwissProt) Alternative ID(s) of Target Chain 8	UniProt (TrEMBL) Submitted Name of Target Chain 8	UniProt (TrEMBL) Entry Name of Target Chain 8	UniProt (TrEMBL) Primary ID of Target Chain 8	UniProt (TrEMBL) Secondary ID(s) of Target Chain 8	UniProt (TrEMBL) Alternative ID(s) of Target Chain 8	BindingDB Target Chain Sequence 9	PDB ID(s) of Target Chain 9	UniProt (SwissProt) Recommended Name of Target Chain 9	UniProt (SwissProt) Entry Name of Target Chain 9	UniProt (SwissProt) Primary ID of Target Chain 9	UniProt (SwissProt) Secondary ID(s) of Target Chain 9	UniProt (SwissProt) Alternative ID(s) of Target Chain 9	UniProt (TrEMBL) Submitted Name of Target Chain 9	UniProt (TrEMBL) Entry Name of Target Chain 9	UniProt (TrEMBL) Primary ID of Target Chain 9	UniProt (TrEMBL) Secondary ID(s) of Target Chain 9	UniProt (TrEMBL) Alternative ID(s) of Target Chain 9	BindingDB Target Chain Sequence 10	PDB ID(s) of Target Chain 10	UniProt (SwissProt) Recommended Name of Target Chain 10	UniProt (SwissProt) Entry Name of Target Chain 10	UniProt (SwissProt) Primary ID of Target Chain 10	UniProt (SwissProt) Secondary ID(s) of Target Chain 10	UniProt (SwissProt) Alternative ID(s) of Target Chain 10	UniProt (TrEMBL) Submitted Name of Target Chain 10	UniProt (TrEMBL) Entry Name of Target Chain 10	UniProt (TrEMBL) Primary ID of Target Chain 10	UniProt (TrEMBL) Secondary ID(s) of Target Chain 10	UniProt (TrEMBL) Alternative ID(s) of Target Chain 10	BindingDB Target Chain Sequence 11	PDB ID(s) of Target Chain 11	UniProt (SwissProt) Recommended Name of Target Chain 11	UniProt (SwissProt) Entry Name of Target Chain 11	UniProt (SwissProt) Primary ID of Target Chain 11	UniProt (SwissProt) Secondary ID(s) of Target Chain 11	UniProt (SwissProt) Alternative ID(s) of Target Chain 11	UniProt (TrEMBL) Submitted Name of Target Chain 11	UniProt (TrEMBL) Entry Name of Target Chain 11	UniProt (TrEMBL) Primary ID of Target Chain 11	UniProt (TrEMBL) Secondary ID(s) of Target Chain 11	UniProt (TrEMBL) Alternative ID(s) of Target Chain 11	BindingDB Target Chain Sequence 12	PDB ID(s) of Target Chain 12	UniProt (SwissProt) Recommended Name of Target Chain 12	UniProt (SwissProt) Entry Name of Target Chain 12	UniProt (SwissProt) Primary ID of Target Chain 12	UniProt (SwissProt) Secondary ID(s) of Target Chain 12	UniProt (SwissProt) Alternative ID(s) of Target Chain 12	UniProt (TrEMBL) Submitted Name of Target Chain 12	UniProt (TrEMBL) Entry Name of Target Chain 12	UniProt (TrEMBL) Primary ID of Target Chain 12	UniProt (TrEMBL) Secondary ID(s) of Target Chain 12	UniProt (TrEMBL) Alternative ID(s) of Target Chain 12	BindingDB Target Chain Sequence 13	PDB ID(s) of Target Chain 13	UniProt (SwissProt) Recommended Name of Target Chain 13	UniProt (SwissProt) Entry Name of Target Chain 13	UniProt (SwissProt) Primary ID of Target Chain 13	UniProt (SwissProt) Secondary ID(s) of Target Chain 13	UniProt (SwissProt) Alternative ID(s) of Target Chain 13	UniProt (TrEMBL) Submitted Name of Target Chain 13	UniProt (TrEMBL) Entry Name of Target Chain 13	UniProt (TrEMBL) Primary ID of Target Chain 13	UniProt (TrEMBL) Secondary ID(s) of Target Chain 13	UniProt (TrEMBL) Alternative ID(s) of Target Chain 13	BindingDB Target Chain Sequence 14	PDB ID(s) of Target Chain 14	UniProt (SwissProt) Recommended Name of Target Chain 14	UniProt (SwissProt) Entry Name of Target Chain 14	UniProt (SwissProt) Primary ID of Target Chain 14	UniProt (SwissProt) Secondary ID(s) of Target Chain 14	UniProt (SwissProt) Alternative ID(s) of Target Chain 14	UniProt (TrEMBL) Submitted Name of Target Chain 14	UniProt (TrEMBL) Entry Name of Target Chain 14	UniProt (TrEMBL) Primary ID of Target Chain 14	UniProt (TrEMBL) Secondary ID(s) of Target Chain 14	UniProt (TrEMBL) Alternative ID(s) of Target Chain 14	BindingDB Target Chain Sequence 15	PDB ID(s) of Target Chain 15	UniProt (SwissProt) Recommended Name of Target Chain 15	UniProt (SwissProt) Entry Name of Target Chain 15	UniProt (SwissProt) Primary ID of Target Chain 15	UniProt (SwissProt) Secondary ID(s) of Target Chain 15	UniProt (SwissProt) Alternative ID(s) of Target Chain 15	UniProt (TrEMBL) Submitted Name of Target Chain 15	UniProt (TrEMBL) Entry Name of Target Chain 15	UniProt (TrEMBL) Primary ID of Target Chain 15	UniProt (TrEMBL) Secondary ID(s) of Target Chain 15	UniProt (TrEMBL) Alternative ID(s) of Target Chain 15	BindingDB Target Chain Sequence 16	PDB ID(s) of Target Chain 16	UniProt (SwissProt) Recommended Name of Target Chain 16	UniProt (SwissProt) Entry Name of Target Chain 16	UniProt (SwissProt) Primary ID of Target Chain 16	UniProt (SwissProt) Secondary ID(s) of Target Chain 16	UniProt (SwissProt) Alternative ID(s) of Target Chain 16	UniProt (TrEMBL) Submitted Name of Target Chain 16	UniProt (TrEMBL) Entry Name of Target Chain 16	UniProt (TrEMBL) Primary ID of Target Chain 16	UniProt (TrEMBL) Secondary ID(s) of Target Chain 16	UniProt (TrEMBL) Alternative ID(s) of Target Chain 16	BindingDB Target Chain Sequence 17	PDB ID(s) of Target Chain 17	UniProt (SwissProt) Recommended Name of Target Chain 17	UniProt (SwissProt) Entry Name of Target Chain 17	UniProt (SwissProt) Primary ID of Target Chain 17	UniProt (SwissProt) Secondary ID(s) of Target Chain 17	UniProt (SwissProt) Alternative ID(s) of Target Chain 17	UniProt (TrEMBL) Submitted Name of Target Chain 17	UniProt (TrEMBL) Entry Name of Target Chain 17	UniProt (TrEMBL) Primary ID of Target Chain 17	UniProt (TrEMBL) Secondary ID(s) of Target Chain 17	UniProt (TrEMBL) Alternative ID(s) of Target Chain 17	BindingDB Target Chain Sequence 18	PDB ID(s) of Target Chain 18	UniProt (SwissProt) Recommended Name of Target Chain 18	UniProt (SwissProt) Entry Name of Target Chain 18	UniProt (SwissProt) Primary ID of Target Chain 18	UniProt (SwissProt) Secondary ID(s) of Target Chain 18	UniProt (SwissProt) Alternative ID(s) of Target Chain 18	UniProt (TrEMBL) Submitted Name of Target Chain 18	UniProt (TrEMBL) Entry Name of Target Chain 18	UniProt (TrEMBL) Primary ID of Target Chain 18	UniProt (TrEMBL) Secondary ID(s) of Target Chain 18	UniProt (TrEMBL) Alternative ID(s) of Target Chain 18	BindingDB Target Chain Sequence 19	PDB ID(s) of Target Chain 19	UniProt (SwissProt) Recommended Name of Target Chain 19	UniProt (SwissProt) Entry Name of Target Chain 19	UniProt (SwissProt) Primary ID of Target Chain 19	UniProt (SwissProt) Secondary ID(s) of Target Chain 19	UniProt (SwissProt) Alternative ID(s) of Target Chain 19	UniProt (TrEMBL) Submitted Name of Target Chain 19	UniProt (TrEMBL) Entry Name of Target Chain 19	UniProt (TrEMBL) Primary ID of Target Chain 19	UniProt (TrEMBL) Secondary ID(s) of Target Chain 19	UniProt (TrEMBL) Alternative ID(s) of Target Chain 19	BindingDB Target Chain Sequence 20	PDB ID(s) of Target Chain 20	UniProt (SwissProt) Recommended Name of Target Chain 20	UniProt (SwissProt) Entry Name of Target Chain 20	UniProt (SwissProt) Primary ID of Target Chain 20	UniProt (SwissProt) Secondary ID(s) of Target Chain 20	UniProt (SwissProt) Alternative ID(s) of Target Chain 20	UniProt (TrEMBL) Submitted Name of Target Chain 20	UniProt (TrEMBL) Entry Name of Target Chain 20	UniProt (TrEMBL) Primary ID of Target Chain 20	UniProt (TrEMBL) Secondary ID(s) of Target Chain 20	UniProt (TrEMBL) Alternative ID(s) of Target Chain 20	BindingDB Target Chain Sequence 21	PDB ID(s) of Target Chain 21	UniProt (SwissProt) Recommended Name of Target Chain 21	UniProt (SwissProt) Entry Name of Target Chain 21	UniProt (SwissProt) Primary ID of Target Chain 21	UniProt (SwissProt) Secondary ID(s) of Target Chain 21	UniProt (SwissProt) Alternative ID(s) of Target Chain 21	UniProt (TrEMBL) Submitted Name of Target Chain 21	UniProt (TrEMBL) Entry Name of Target Chain 21	UniProt (TrEMBL) Primary ID of Target Chain 21	UniProt (TrEMBL) Secondary ID(s) of Target Chain 21	UniProt (TrEMBL) Alternative ID(s) of Target Chain 21	BindingDB Target Chain Sequence 22	PDB ID(s) of Target Chain 22	UniProt (SwissProt) Recommended Name of Target Chain 22	UniProt (SwissProt) Entry Name of Target Chain 22	UniProt (SwissProt) Primary ID of Target Chain 22	UniProt (SwissProt) Secondary ID(s) of Target Chain 22	UniProt (SwissProt) Alternative ID(s) of Target Chain 22	UniProt (TrEMBL) Submitted Name of Target Chain 22	UniProt (TrEMBL) Entry Name of Target Chain 22	UniProt (TrEMBL) Primary ID of Target Chain 22	UniProt (TrEMBL) Secondary ID(s) of Target Chain 22	UniProt (TrEMBL) Alternative ID(s) of Target Chain 22	BindingDB Target Chain Sequence 23	PDB ID(s) of Target Chain 23	UniProt (SwissProt) Recommended Name of Target Chain 23	UniProt (SwissProt) Entry Name of Target Chain 23	UniProt (SwissProt) Primary ID of Target Chain 23	UniProt (SwissProt) Secondary ID(s) of Target Chain 23	UniProt (SwissProt) Alternative ID(s) of Target Chain 23	UniProt (TrEMBL) Submitted Name of Target Chain 23	UniProt (TrEMBL) Entry Name of Target Chain 23	UniProt (TrEMBL) Primary ID of Target Chain 23	UniProt (TrEMBL) Secondary ID(s) of Target Chain 23	UniProt (TrEMBL) Alternative ID(s) of Target Chain 23	BindingDB Target Chain Sequence 24	PDB ID(s) of Target Chain 24	UniProt (SwissProt) Recommended Name of Target Chain 24	UniProt (SwissProt) Entry Name of Target Chain 24	UniProt (SwissProt) Primary ID of Target Chain 24	UniProt (SwissProt) Secondary ID(s) of Target Chain 24	UniProt (SwissProt) Alternative ID(s) of Target Chain 24	UniProt (TrEMBL) Submitted Name of Target Chain 24	UniProt (TrEMBL) Entry Name of Target Chain 24	UniProt (TrEMBL) Primary ID of Target Chain 24	UniProt (TrEMBL) Secondary ID(s) of Target Chain 24	UniProt (TrEMBL) Alternative ID(s) of Target Chain 24	BindingDB Target Chain Sequence 25	PDB ID(s) of Target Chain 25	UniProt (SwissProt) Recommended Name of Target Chain 25	UniProt (SwissProt) Entry Name of Target Chain 25	UniProt (SwissProt) Primary ID of Target Chain 25	UniProt (SwissProt) Secondary ID(s) of Target Chain 25	UniProt (SwissProt) Alternative ID(s) of Target Chain 25	UniProt (TrEMBL) Submitted Name of Target Chain 25	UniProt (TrEMBL) Entry Name of Target Chain 25	UniProt (TrEMBL) Primary ID of Target Chain 25	UniProt (TrEMBL) Secondary ID(s) of Target Chain 25	UniProt (TrEMBL) Alternative ID(s) of Target Chain 25	BindingDB Target Chain Sequence 26	PDB ID(s) of Target Chain 26	UniProt (SwissProt) Recommended Name of Target Chain 26	UniProt (SwissProt) Entry Name of Target Chain 26	UniProt (SwissProt) Primary ID of Target Chain 26	UniProt (SwissProt) Secondary ID(s) of Target Chain 26	UniProt (SwissProt) Alternative ID(s) of Target Chain 26	UniProt (TrEMBL) Submitted Name of Target Chain 26	UniProt (TrEMBL) Entry Name of Target Chain 26	UniProt (TrEMBL) Primary ID of Target Chain 26	UniProt (TrEMBL) Secondary ID(s) of Target Chain 26	UniProt (TrEMBL) Alternative ID(s) of Target Chain 26	BindingDB Target Chain Sequence 27	PDB ID(s) of Target Chain 27	UniProt (SwissProt) Recommended Name of Target Chain 27	UniProt (SwissProt) Entry Name of Target Chain 27	UniProt (SwissProt) Primary ID of Target Chain 27	UniProt (SwissProt) Secondary ID(s) of Target Chain 27	UniProt (SwissProt) Alternative ID(s) of Target Chain 27	UniProt (TrEMBL) Submitted Name of Target Chain 27	UniProt (TrEMBL) Entry Name of Target Chain 27	UniProt (TrEMBL) Primary ID of Target Chain 27	UniProt (TrEMBL) Secondary ID(s) of Target Chain 27	UniProt (TrEMBL) Alternative ID(s) of Target Chain 27	BindingDB Target Chain Sequence 28	PDB ID(s) of Target Chain 28	UniProt (SwissProt) Recommended Name of Target Chain 28	UniProt (SwissProt) Entry Name of Target Chain 28	UniProt (SwissProt) Primary ID of Target Chain 28	UniProt (SwissProt) Secondary ID(s) of Target Chain 28	UniProt (SwissProt) Alternative ID(s) of Target Chain 28	UniProt (TrEMBL) Submitted Name of Target Chain 28	UniProt (TrEMBL) Entry Name of Target Chain 28	UniProt (TrEMBL) Primary ID of Target Chain 28	UniProt (TrEMBL) Secondary ID(s) of Target Chain 28	UniProt (TrEMBL) Alternative ID(s) of Target Chain 28	BindingDB Target Chain Sequence 29	PDB ID(s) of Target Chain 29	UniProt (SwissProt) Recommended Name of Target Chain 29	UniProt (SwissProt) Entry Name of Target Chain 29	UniProt (SwissProt) Primary ID of Target Chain 29	UniProt (SwissProt) Secondary ID(s) of Target Chain 29	UniProt (SwissProt) Alternative ID(s) of Target Chain 29	UniProt (TrEMBL) Submitted Name of Target Chain 29	UniProt (TrEMBL) Entry Name of Target Chain 29	UniProt (TrEMBL) Primary ID of Target Chain 29	UniProt (TrEMBL) Secondary ID(s) of Target Chain 29	UniProt (TrEMBL) Alternative ID(s) of Target Chain 29	BindingDB Target Chain Sequence 30	PDB ID(s) of Target Chain 30	UniProt (SwissProt) Recommended Name of Target Chain 30	UniProt (SwissProt) Entry Name of Target Chain 30	UniProt (SwissProt) Primary ID of Target Chain 30	UniProt (SwissProt) Secondary ID(s) of Target Chain 30	UniProt (SwissProt) Alternative ID(s) of Target Chain 30	UniProt (TrEMBL) Submitted Name of Target Chain 30	UniProt (TrEMBL) Entry Name of Target Chain 30	UniProt (TrEMBL) Primary ID of Target Chain 30	UniProt (TrEMBL) Secondary ID(s) of Target Chain 30	UniProt (TrEMBL) Alternative ID(s) of Target Chain 30	BindingDB Target Chain Sequence 31	PDB ID(s) of Target Chain 31	UniProt (SwissProt) Recommended Name of Target Chain 31	UniProt (SwissProt) Entry Name of Target Chain 31	UniProt (SwissProt) Primary ID of Target Chain 31	UniProt (SwissProt) Secondary ID(s) of Target Chain 31	UniProt (SwissProt) Alternative ID(s) of Target Chain 31	UniProt (TrEMBL) Submitted Name of Target Chain 31	UniProt (TrEMBL) Entry Name of Target Chain 31	UniProt (TrEMBL) Primary ID of Target Chain 31	UniProt (TrEMBL) Secondary ID(s) of Target Chain 31	UniProt (TrEMBL) Alternative ID(s) of Target Chain 31	BindingDB Target Chain Sequence 32	PDB ID(s) of Target Chain 32	UniProt (SwissProt) Recommended Name of Target Chain 32	UniProt (SwissProt) Entry Name of Target Chain 32	UniProt (SwissProt) Primary ID of Target Chain 32	UniProt (SwissProt) Secondary ID(s) of Target Chain 32	UniProt (SwissProt) Alternative ID(s) of Target Chain 32	UniProt (TrEMBL) Submitted Name of Target Chain 32	UniProt (TrEMBL) Entry Name of Target Chain 32	UniProt (TrEMBL) Primary ID of Target Chain 32	UniProt (TrEMBL) Secondary ID(s) of Target Chain 32	UniProt (TrEMBL) Alternative ID(s) of Target Chain 32	BindingDB Target Chain Sequence 33	PDB ID(s) of Target Chain 33	UniProt (SwissProt) Recommended Name of Target Chain 33	UniProt (SwissProt) Entry Name of Target Chain 33	UniProt (SwissProt) Primary ID of Target Chain 33	UniProt (SwissProt) Secondary ID(s) of Target Chain 33	UniProt (SwissProt) Alternative ID(s) of Target Chain 33	UniProt (TrEMBL) Submitted Name of Target Chain 33	UniProt (TrEMBL) Entry Name of Target Chain 33	UniProt (TrEMBL) Primary ID of Target Chain 33	UniProt (TrEMBL) Secondary ID(s) of Target Chain 33	UniProt (TrEMBL) Alternative ID(s) of Target Chain 33	BindingDB Target Chain Sequence 34	PDB ID(s) of Target Chain 34	UniProt (SwissProt) Recommended Name of Target Chain 34	UniProt (SwissProt) Entry Name of Target Chain 34	UniProt (SwissProt) Primary ID of Target Chain 34	UniProt (SwissProt) Secondary ID(s) of Target Chain 34	UniProt (SwissProt) Alternative ID(s) of Target Chain 34	UniProt (TrEMBL) Submitted Name of Target Chain 34	UniProt (TrEMBL) Entry Name of Target Chain 34	UniProt (TrEMBL) Primary ID of Target Chain 34	UniProt (TrEMBL) Secondary ID(s) of Target Chain 34	UniProt (TrEMBL) Alternative ID(s) of Target Chain 34	BindingDB Target Chain Sequence 35	PDB ID(s) of Target Chain 35	UniProt (SwissProt) Recommended Name of Target Chain 35	UniProt (SwissProt) Entry Name of Target Chain 35	UniProt (SwissProt) Primary ID of Target Chain 35	UniProt (SwissProt) Secondary ID(s) of Target Chain 35	UniProt (SwissProt) Alternative ID(s) of Target Chain 35	UniProt (TrEMBL) Submitted Name of Target Chain 35	UniProt (TrEMBL) Entry Name of Target Chain 35	UniProt (TrEMBL) Primary ID of Target Chain 35	UniProt (TrEMBL) Secondary ID(s) of Target Chain 35	UniProt (TrEMBL) Alternative ID(s) of Target Chain 35	BindingDB Target Chain Sequence 36	PDB ID(s) of Target Chain 36	UniProt (SwissProt) Recommended Name of Target Chain 36	UniProt (SwissProt) Entry Name of Target Chain 36	UniProt (SwissProt) Primary ID of Target Chain 36	UniProt (SwissProt) Secondary ID(s) of Target Chain 36	UniProt (SwissProt) Alternative ID(s) of Target Chain 36	UniProt (TrEMBL) Submitted Name of Target Chain 36	UniProt (TrEMBL) Entry Name of Target Chain 36	UniProt (TrEMBL) Primary ID of Target Chain 36	UniProt (TrEMBL) Secondary ID(s) of Target Chain 36	UniProt (TrEMBL) Alternative ID(s) of Target Chain 36	BindingDB Target Chain Sequence 37	PDB ID(s) of Target Chain 37	UniProt (SwissProt) Recommended Name of Target Chain 37	UniProt (SwissProt) Entry Name of Target Chain 37	UniProt (SwissProt) Primary ID of Target Chain 37	UniProt (SwissProt) Secondary ID(s) of Target Chain 37	UniProt (SwissProt) Alternative ID(s) of Target Chain 37	UniProt (TrEMBL) Submitted Name of Target Chain 37	UniProt (TrEMBL) Entry Name of Target Chain 37	UniProt (TrEMBL) Primary ID of Target Chain 37	UniProt (TrEMBL) Secondary ID(s) of Target Chain 37	UniProt (TrEMBL) Alternative ID(s) of Target Chain 37	BindingDB Target Chain Sequence 38	PDB ID(s) of Target Chain 38	UniProt (SwissProt) Recommended Name of Target Chain 38	UniProt (SwissProt) Entry Name of Target Chain 38	UniProt (SwissProt) Primary ID of Target Chain 38	UniProt (SwissProt) Secondary ID(s) of Target Chain 38	UniProt (SwissProt) Alternative ID(s) of Target Chain 38	UniProt (TrEMBL) Submitted Name of Target Chain 38	UniProt (TrEMBL) Entry Name of Target Chain 38	UniProt (TrEMBL) Primary ID of Target Chain 38	UniProt (TrEMBL) Secondary ID(s) of Target Chain 38	UniProt (TrEMBL) Alternative ID(s) of Target Chain 38	BindingDB Target Chain Sequence 39	PDB ID(s) of Target Chain 39	UniProt (SwissProt) Recommended Name of Target Chain 39	UniProt (SwissProt) Entry Name of Target Chain 39	UniProt (SwissProt) Primary ID of Target Chain 39	UniProt (SwissProt) Secondary ID(s) of Target Chain 39	UniProt (SwissProt) Alternative ID(s) of Target Chain 39	UniProt (TrEMBL) Submitted Name of Target Chain 39	UniProt (TrEMBL) Entry Name of Target Chain 39	UniProt (TrEMBL) Primary ID of Target Chain 39	UniProt (TrEMBL) Secondary ID(s) of Target Chain 39	UniProt (TrEMBL) Alternative ID(s) of Target Chain 39	BindingDB Target Chain Sequence 40	PDB ID(s) of Target Chain 40	UniProt (SwissProt) Recommended Name of Target Chain 40	UniProt (SwissProt) Entry Name of Target Chain 40	UniProt (SwissProt) Primary ID of Target Chain 40	UniProt (SwissProt) Secondary ID(s) of Target Chain 40	UniProt (SwissProt) Alternative ID(s) of Target Chain 40	UniProt (TrEMBL) Submitted Name of Target Chain 40	UniProt (TrEMBL) Entry Name of Target Chain 40	UniProt (TrEMBL) Primary ID of Target Chain 40	UniProt (TrEMBL) Secondary ID(s) of Target Chain 40	UniProt (TrEMBL) Alternative ID(s) of Target Chain 40	BindingDB Target Chain Sequence 41	PDB ID(s) of Target Chain 41	UniProt (SwissProt) Recommended Name of Target Chain 41	UniProt (SwissProt) Entry Name of Target Chain 41	UniProt (SwissProt) Primary ID of Target Chain 41	UniProt (SwissProt) Secondary ID(s) of Target Chain 41	UniProt (SwissProt) Alternative ID(s) of Target Chain 41	UniProt (TrEMBL) Submitted Name of Target Chain 41	UniProt (TrEMBL) Entry Name of Target Chain 41	UniProt (TrEMBL) Primary ID of Target Chain 41	UniProt (TrEMBL) Secondary ID(s) of Target Chain 41	UniProt (TrEMBL) Alternative ID(s) of Target Chain 41	BindingDB Target Chain Sequence 42	PDB ID(s) of Target Chain 42	UniProt (SwissProt) Recommended Name of Target Chain 42	UniProt (SwissProt) Entry Name of Target Chain 42	UniProt (SwissProt) Primary ID of Target Chain 42	UniProt (SwissProt) Secondary ID(s) of Target Chain 42	UniProt (SwissProt) Alternative ID(s) of Target Chain 42	UniProt (TrEMBL) Submitted Name of Target Chain 42	UniProt (TrEMBL) Entry Name of Target Chain 42	UniProt (TrEMBL) Primary ID of Target Chain 42	UniProt (TrEMBL) Secondary ID(s) of Target Chain 42	UniProt (TrEMBL) Alternative ID(s) of Target Chain 42	BindingDB Target Chain Sequence 43	PDB ID(s) of Target Chain 43	UniProt (SwissProt) Recommended Name of Target Chain 43	UniProt (SwissProt) Entry Name of Target Chain 43	UniProt (SwissProt) Primary ID of Target Chain 43	UniProt (SwissProt) Secondary ID(s) of Target Chain 43	UniProt (SwissProt) Alternative ID(s) of Target Chain 43	UniProt (TrEMBL) Submitted Name of Target Chain 43	UniProt (TrEMBL) Entry Name of Target Chain 43	UniProt (TrEMBL) Primary ID of Target Chain 43	UniProt (TrEMBL) Secondary ID(s) of Target Chain 43	UniProt (TrEMBL) Alternative ID(s) of Target Chain 43	BindingDB Target Chain Sequence 44	PDB ID(s) of Target Chain 44	UniProt (SwissProt) Recommended Name of Target Chain 44	UniProt (SwissProt) Entry Name of Target Chain 44	UniProt (SwissProt) Primary ID of Target Chain 44	UniProt (SwissProt) Secondary ID(s) of Target Chain 44	UniProt (SwissProt) Alternative ID(s) of Target Chain 44	UniProt (TrEMBL) Submitted Name of Target Chain 44	UniProt (TrEMBL) Entry Name of Target Chain 44	UniProt (TrEMBL) Primary ID of Target Chain 44	UniProt (TrEMBL) Secondary ID(s) of Target Chain 44	UniProt (TrEMBL) Alternative ID(s) of Target Chain 44	BindingDB Target Chain Sequence 45	PDB ID(s) of Target Chain 45	UniProt (SwissProt) Recommended Name of Target Chain 45	UniProt (SwissProt) Entry Name of Target Chain 45	UniProt (SwissProt) Primary ID of Target Chain 45	UniProt (SwissProt) Secondary ID(s) of Target Chain 45	UniProt (SwissProt) Alternative ID(s) of Target Chain 45	UniProt (TrEMBL) Submitted Name of Target Chain 45	UniProt (TrEMBL) Entry Name of Target Chain 45	UniProt (TrEMBL) Primary ID of Target Chain 45	UniProt (TrEMBL) Secondary ID(s) of Target Chain 45	UniProt (TrEMBL) Alternative ID(s) of Target Chain 45	BindingDB Target Chain Sequence 46	PDB ID(s) of Target Chain 46	UniProt (SwissProt) Recommended Name of Target Chain 46	UniProt (SwissProt) Entry Name of Target Chain 46	UniProt (SwissProt) Primary ID of Target Chain 46	UniProt (SwissProt) Secondary ID(s) of Target Chain 46	UniProt (SwissProt) Alternative ID(s) of Target Chain 46	UniProt (TrEMBL) Submitted Name of Target Chain 46	UniProt (TrEMBL) Entry Name of Target Chain 46	UniProt (TrEMBL) Primary ID of Target Chain 46	UniProt (TrEMBL) Secondary ID(s) of Target Chain 46	UniProt (TrEMBL) Alternative ID(s) of Target Chain 46	BindingDB Target Chain Sequence 47	PDB ID(s) of Target Chain 47	UniProt (SwissProt) Recommended Name of Target Chain 47	UniProt (SwissProt) Entry Name of Target Chain 47	UniProt (SwissProt) Primary ID of Target Chain 47	UniProt (SwissProt) Secondary ID(s) of Target Chain 47	UniProt (SwissProt) Alternative ID(s) of Target Chain 47	UniProt (TrEMBL) Submitted Name of Target Chain 47	UniProt (TrEMBL) Entry Name of Target Chain 47	UniProt (TrEMBL) Primary ID of Target Chain 47	UniProt (TrEMBL) Secondary ID(s) of Target Chain 47	UniProt (TrEMBL) Alternative ID(s) of Target Chain 47	BindingDB Target Chain Sequence 48	PDB ID(s) of Target Chain 48	UniProt (SwissProt) Recommended Name of Target Chain 48	UniProt (SwissProt) Entry Name of Target Chain 48	UniProt (SwissProt) Primary ID of Target Chain 48	UniProt (SwissProt) Secondary ID(s) of Target Chain 48	UniProt (SwissProt) Alternative ID(s) of Target Chain 48	UniProt (TrEMBL) Submitted Name of Target Chain 48	UniProt (TrEMBL) Entry Name of Target Chain 48	UniProt (TrEMBL) Primary ID of Target Chain 48	UniProt (TrEMBL) Secondary ID(s) of Target Chain 48	UniProt (TrEMBL) Alternative ID(s) of Target Chain 48	BindingDB Target Chain Sequence 49	PDB ID(s) of Target Chain 49	UniProt (SwissProt) Recommended Name of Target Chain 49	UniProt (SwissProt) Entry Name of Target Chain 49	UniProt (SwissProt) Primary ID of Target Chain 49	UniProt (SwissProt) Secondary ID(s) of Target Chain 49	UniProt (SwissProt) Alternative ID(s) of Target Chain 49	UniProt (TrEMBL) Submitted Name of Target Chain 49	UniProt (TrEMBL) Entry Name of Target Chain 49	UniProt (TrEMBL) Primary ID of Target Chain 49	UniProt (TrEMBL) Secondary ID(s) of Target Chain 49	UniProt (TrEMBL) Alternative ID(s) of Target Chain 49	BindingDB Target Chain Sequence 50	PDB ID(s) of Target Chain 50	UniProt (SwissProt) Recommended Name of Target Chain 50	UniProt (SwissProt) Entry Name of Target Chain 50	UniProt (SwissProt) Primary ID of Target Chain 50	UniProt (SwissProt) Secondary ID(s) of Target Chain 50	UniProt (SwissProt) Alternative ID(s) of Target Chain 50	UniProt (TrEMBL) Submitted Name of Target Chain 50	UniProt (TrEMBL) Entry Name of Target Chain 50	UniProt (TrEMBL) Primary ID of Target Chain 50	UniProt (TrEMBL) Secondary ID(s) of Target Chain 50	UniProt (TrEMBL) Alternative ID(s) of Target Chain 50
51587182	COc1cc(CNCCO)nc(Nc2ccccc2)n1	InChI=1S/C14H18N4O2/c1-20-13-9-12(10-15-7-8-19)17-14(18-13)16-11-5-3-2-4-6-11/h2-6,9,15,19H,7-8,10H2,1H3,(H,16,17,18)	JIXXYAKFEJYLOZ-UHFFFAOYSA-N	50639006	CHEMBL5556520	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 22910						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639006	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639006&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101449	519659409							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587183	COc1cc(CNCCO)nc(Nc2cccc(C)c2)n1	InChI=1S/C15H20N4O2/c1-11-4-3-5-12(8-11)17-15-18-13(10-16-6-7-20)9-14(19-15)21-2/h3-5,8-9,16,20H,6-7,10H2,1-2H3,(H,17,18,19)	NIRONBNFTJLPFY-UHFFFAOYSA-N	50639007	CHEMBL5556251	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 4150						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639007	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639007&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101441	519659410							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587184	COc1cc(CNCCO)nc(Nc2cccc(-c3ccccc3)c2)n1	InChI=1S/C20H22N4O2/c1-26-19-13-18(14-21-10-11-25)23-20(24-19)22-17-9-5-8-16(12-17)15-6-3-2-4-7-15/h2-9,12-13,21,25H,10-11,14H2,1H3,(H,22,23,24)	XOBKVBMMKFMAHS-UHFFFAOYSA-N	50639008	CHEMBL5556512	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 1620						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639008	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639008&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101436	519659411							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587185	COc1cc(CNCCO)nc(Nc2cccc(O)c2)n1	InChI=1S/C14H18N4O3/c1-21-13-8-11(9-15-5-6-19)17-14(18-13)16-10-3-2-4-12(20)7-10/h2-4,7-8,15,19-20H,5-6,9H2,1H3,(H,16,17,18)	KCTPHIOYWMANBF-UHFFFAOYSA-N	50639009	CHEMBL5561473	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 490						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639009	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639009&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101447	519659412							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587186	COc1cccc(Nc2nc(CNCCO)cc(OC)n2)c1	InChI=1S/C15H20N4O3/c1-21-13-5-3-4-11(8-13)17-15-18-12(10-16-6-7-20)9-14(19-15)22-2/h3-5,8-9,16,20H,6-7,10H2,1-2H3,(H,17,18,19)	QAOQGYPYDAPNHH-UHFFFAOYSA-N	50639010	CHEMBL5562253	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 4950						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639010	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639010&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101445	519659413							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587187	COc1cc(CNCCO)nc(Nc2cccc(N3CCOCC3)c2)n1	InChI=1S/C18H25N5O3/c1-25-17-12-15(13-19-5-8-24)21-18(22-17)20-14-3-2-4-16(11-14)23-6-9-26-10-7-23/h2-4,11-12,19,24H,5-10,13H2,1H3,(H,20,21,22)	BZWVOWWZMUEQEE-UHFFFAOYSA-N	50639011	CHEMBL5555758	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 3380						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639011	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639011&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101435	519659414							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587188	COc1cc(CNCCO)nc(Nc2cccc(Cl)c2)n1	InChI=1S/C14H17ClN4O2/c1-21-13-8-12(9-16-5-6-20)18-14(19-13)17-11-4-2-3-10(15)7-11/h2-4,7-8,16,20H,5-6,9H2,1H3,(H,17,18,19)	JPNAORKUVCQTLU-UHFFFAOYSA-N	50639012	CHEMBL5556778	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639012	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639012&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376289	519659415							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587189	COc1cc(CNCCO)nc(Nc2cccc([N+](=O)[O-])c2)n1	InChI=1S/C14H17N5O4/c1-23-13-8-11(9-15-5-6-20)17-14(18-13)16-10-3-2-4-12(7-10)19(21)22/h2-4,7-8,15,20H,5-6,9H2,1H3,(H,16,17,18)	VFTHBWSPILQUDV-UHFFFAOYSA-N	50639013	CHEMBL5532044	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639013	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639013&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376290	519659416							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587190	COc1cc(CNCCO)nc(Nc2ccccc2O)n1	InChI=1S/C14H18N4O3/c1-21-13-8-10(9-15-6-7-19)16-14(18-13)17-11-4-2-3-5-12(11)20/h2-5,8,15,19-20H,6-7,9H2,1H3,(H,16,17,18)	UBWAHEQCCPLVBR-UHFFFAOYSA-N	50639014	CHEMBL5561488	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 2390						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639014	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639014&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101438	519659417							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587191	COc1cc(CNCCO)nc(Nc2ccc(O)cc2)n1	InChI=1S/C14H18N4O3/c1-21-13-8-11(9-15-6-7-19)17-14(18-13)16-10-2-4-12(20)5-3-10/h2-5,8,15,19-20H,6-7,9H2,1H3,(H,16,17,18)	PSXLXAFFYHGMNN-UHFFFAOYSA-N	50639015	CHEMBL5555221	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 4160						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639015	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639015&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101439	519659418							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587192	COc1cc(CNCCO)nc(Nc2ccc3c(c2)OCCO3)n1	InChI=1S/C16H20N4O4/c1-22-15-9-12(10-17-4-5-21)19-16(20-15)18-11-2-3-13-14(8-11)24-7-6-23-13/h2-3,8-9,17,21H,4-7,10H2,1H3,(H,18,19,20)	VKMGCCLVFRPGDA-UHFFFAOYSA-N	50639016	CHEMBL5557943	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639016	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639016&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376291	519659419							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587193	COC1C=C(CNCCNC(C)=O)N=C(Nc2cccc(O)c2)N1	InChI=1S/C16H23N5O3/c1-11(22)18-7-6-17-10-13-9-15(24-2)21-16(20-13)19-12-4-3-5-14(23)8-12/h3-5,8-9,15,17,23H,6-7,10H2,1-2H3,(H,18,22)(H2,19,20,21)	ZBNBLHQDOAMPFE-UHFFFAOYSA-N	50639017	CHEMBL5558985	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 4730						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639017	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639017&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376292	519659420							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587194	CCN(c1ccccc1)c1n/c(=N/Cc2ccc(-c3ccccc3)o2)ss1	InChI=1S/C21H19N3OS2/c1-2-24(17-11-7-4-8-12-17)21-23-20(26-27-21)22-15-18-13-14-19(25-18)16-9-5-3-6-10-16/h3-14H,2,15H2,1H3	USOABWYTGIGCFB-UHFFFAOYSA-N	50639018	CHEMBL5568380	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 24000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639018	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639018&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			162755341	519659421							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587195	O=c1cc(CNCCO)nc(Nc2ccccc2)[nH]1	InChI=1S/C13H16N4O2/c18-7-6-14-9-11-8-12(19)17-13(16-11)15-10-4-2-1-3-5-10/h1-5,8,14,18H,6-7,9H2,(H2,15,16,17,19)	QSNQKHRIXJCBNT-UHFFFAOYSA-N	50639019	CHEMBL5556055	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 10660						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639019	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639019&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101443	519659422							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587196	O=c1cc(CNCCO)nc(Nc2cccc(-c3ccccc3)c2)[nH]1	InChI=1S/C19H20N4O2/c24-10-9-20-13-17-12-18(25)23-19(22-17)21-16-8-4-7-15(11-16)14-5-2-1-3-6-14/h1-8,11-12,20,24H,9-10,13H2,(H2,21,22,23,25)	RHMSLJUYTZJPHJ-UHFFFAOYSA-N	50639020	CHEMBL5562243	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 2750						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639020	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639020&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101444	519659423							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587197	O=c1cc(CNCCO)nc(Nc2cccc(O)c2)[nH]1	InChI=1S/C13H16N4O3/c18-5-4-14-8-10-7-12(20)17-13(16-10)15-9-2-1-3-11(19)6-9/h1-3,6-7,14,18-19H,4-5,8H2,(H2,15,16,17,20)	JJFVUSQMAJLJFN-UHFFFAOYSA-N	50639021	CHEMBL5555853	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 760						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639021	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639021&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101442	519659424							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587198	CC(=O)NCCNCc1cc(=O)[nH]c(Nc2cccc(O)c2)n1	InChI=1S/C15H19N5O3/c1-10(21)17-6-5-16-9-12-8-14(23)20-15(19-12)18-11-3-2-4-13(22)7-11/h2-4,7-8,16,22H,5-6,9H2,1H3,(H,17,21)(H2,18,19,20,23)	XBJYNQHCOIYQTA-UHFFFAOYSA-N	50639022	CHEMBL5568015	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 5680						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639022	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639022&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376293	519659425							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587199	CC(C)(C)OC(=O)CNCc1cc(=O)[nH]c(Nc2cccc(O)c2)n1	InChI=1S/C17H22N4O4/c1-17(2,3)25-15(24)10-18-9-12-8-14(23)21-16(20-12)19-11-5-4-6-13(22)7-11/h4-8,18,22H,9-10H2,1-3H3,(H2,19,20,21,23)	YLBAZQFWWLPOOZ-UHFFFAOYSA-N	50639023	CHEMBL5556222	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 21000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639023	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639023&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376294	519659426							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587200	CC(C)CCNCc1cc(=O)[nH]c(Nc2cccc(O)c2)n1	InChI=1S/C16H22N4O2/c1-11(2)6-7-17-10-13-9-15(22)20-16(19-13)18-12-4-3-5-14(21)8-12/h3-5,8-9,11,17,21H,6-7,10H2,1-2H3,(H2,18,19,20,22)	PGRCPHLUULZFHC-UHFFFAOYSA-N	50639024	CHEMBL5559450	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639024	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639024&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376295	519659427							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587201	O=c1cc(CNc2ccccc2)nc(Nc2cccc(O)c2)[nH]1	InChI=1S/C17H16N4O2/c22-15-8-4-7-13(9-15)19-17-20-14(10-16(23)21-17)11-18-12-5-2-1-3-6-12/h1-10,18,22H,11H2,(H2,19,20,21,23)	ZEOPRZOJWLROLL-UHFFFAOYSA-N	50639025	CHEMBL5555355	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639025	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639025&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376296	519659428							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587202	O=c1cc(CNC2CCCCC2)nc(Nc2cccc(O)c2)[nH]1	InChI=1S/C17H22N4O2/c22-15-8-4-7-13(9-15)19-17-20-14(10-16(23)21-17)11-18-12-5-2-1-3-6-12/h4,7-10,12,18,22H,1-3,5-6,11H2,(H2,19,20,21,23)	HPYVMGLYOLWQPY-UHFFFAOYSA-N	50639026	CHEMBL5561796	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639026	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639026&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376297	519659429							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587203	CN1CCN(Cc2cc(=O)[nH]c(Nc3cccc(O)c3)n2)CC1=O	InChI=1S/C16H19N5O3/c1-20-5-6-21(10-15(20)24)9-12-8-14(23)19-16(18-12)17-11-3-2-4-13(22)7-11/h2-4,7-8,22H,5-6,9-10H2,1H3,(H2,17,18,19,23)	QTUAYALMCOUJEO-UHFFFAOYSA-N	50639027	CHEMBL5556659	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639027	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639027&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376298	519659430							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587204	O=c1cc(CN2CC[C@H](O)C2)nc(Nc2cccc(O)c2)[nH]1	InChI=1S/C15H18N4O3/c20-12-3-1-2-10(6-12)16-15-17-11(7-14(22)18-15)8-19-5-4-13(21)9-19/h1-3,6-7,13,20-21H,4-5,8-9H2,(H2,16,17,18,22)	FYFQCWLADQVPTB-UHFFFAOYSA-N	50639028	CHEMBL5560581	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			>100000						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639028	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639028&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			177376299	519659431							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587205	COc1cc(CNCCO)nc(Nc2cccc(O)c2)n1	InChI=1S/C14H18N4O3/c1-21-13-8-11(9-15-5-6-19)17-14(18-13)16-10-3-2-4-12(20)7-10/h2-4,7-8,15,19-20H,5-6,9H2,1H3,(H,16,17,18)	KCTPHIOYWMANBF-UHFFFAOYSA-N	50639009	CHEMBL5561473	V-type immunoglobulin domain-containing suppressor of T-cell activation	Mus musculus			 750						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639009	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001458&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639009&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			169101447	519659412							1	MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_MOUSE	Q9D659	A3RLQ7 E9PUF5 Q6KAT9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587206	CCN(c1ccccc1)c1n/c(=N/Cc2ccc(-c3ccccc3)o2)ss1	InChI=1S/C21H19N3OS2/c1-2-24(17-11-7-4-8-12-17)21-23-20(26-27-21)22-15-18-13-14-19(25-18)16-9-5-3-6-10-16/h3-14H,2,15H2,1H3	USOABWYTGIGCFB-UHFFFAOYSA-N	50639018	CHEMBL5568380	V-type immunoglobulin domain-containing suppressor of T-cell activation	Human			 247						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50639018	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50000832&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50639018&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			162755341	519659421							1	MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_HUMAN	Q9H7M9	A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
51587207	Cc1nnc(SCc2cc(O)nc(Nc3nc(C)c4cc(C)ccc4n3)n2)s1	InChI=1S/C18H17N7OS2/c1-9-4-5-14-13(6-9)10(2)19-16(21-14)23-17-20-12(7-15(26)22-17)8-27-18-25-24-11(3)28-18/h4-7H,8H2,1-3H3,(H2,19,20,21,22,23,26)	YIJOQQHVEVIMNS-UHFFFAOYSA-N	50590859	CHEMBL1322633	V-type immunoglobulin domain-containing suppressor of T-cell activation				 647						ChEMBL		10.7270/Q23R0ZG0	38412237			Sun, C; He, Y; Wang, G; Zhang, G; Zhang, Y; Shen, H; Hu, L; Sun, Y; Jiang, B; Wang, X; Yuan, K; Min, W; Wang, L; Sun, H; Xiao, Y; Yang, P	//0	10/11/2025	China Pharmaceutical University	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50590859	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=50001458&target=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50590859&enzyme=V-type+immunoglobulin+domain-containing+suppressor+of+T-cell+activation&column=ki&startPg=0&Increment=50&submit=Search			135416156	482601711							1	MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI		V-type immunoglobulin domain-containing suppressor of T-cell activation	VISTA_MOUSE	Q9D659	A3RLQ7 E9PUF5 Q6KAT9																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																																		
